PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_13396-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB_related
Protein Properties Length: 102aa    MW: 11997.1 Da    PI: 10.297
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_13396-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.31.3e-162468147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT+ E++++++a k++G   W +I +++g ++t+ q++s+ qk+
  TRIUR3_13396-P1 24 RERWTEAEHKRFLEALKLYGRA-WQRIEEHVG-TKTAVQIRSHAQKF 68
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.98E-171871IPR009057Homeodomain-like
PROSITE profilePS5129419.1971973IPR017930Myb domain
TIGRFAMsTIGR015575.9E-182271IPR006447Myb domain, plants
SMARTSM007176.5E-122371IPR001005SANT/Myb domain
PfamPF002496.1E-142467IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-92464IPR009057Homeodomain-like
CDDcd001679.20E-92669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 102 aa     Download sequence    Send to blast
MEINSSGEET VIKVRKPYTI TKQRERWTEA EHKRFLEALK LYGRAWQRIE EHVGTKTAVQ  60
IRSHAQKFFT KLCTAVLSMM KDSFPLNIMR TILYLIVALL ID
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3609661e-105AK360966.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1129K17.
GenBankHQ2226061e-105HQ222606.1 Triticum aestivum LHY mRNA, complete cds.
GenBankJN6032421e-105JN603242.1 Hordeum vulgare circadian clock associated 1 (CCA1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008661387.19e-44PREDICTED: LHY protein isoform X3
RefseqXP_008677179.11e-43PREDICTED: LHY protein isoform X1
RefseqXP_008677180.11e-43PREDICTED: LHY protein isoform X1
RefseqXP_008677181.11e-43PREDICTED: LHY protein isoform X1
RefseqXP_008677182.11e-43PREDICTED: LHY protein isoform X1
RefseqXP_008677183.11e-43PREDICTED: LHY protein isoform X1
SwissprotQ6R0H12e-39LHY_ARATH; Protein LHY
TrEMBLM7ZK993e-71M7ZK99_TRIUA; Protein LHY
STRINGGRMZM2G175265_P015e-46(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27223686
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.49e-41MYB_related family protein